PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_8A9D9ACCB.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 243aa    MW: 25922.2 Da    PI: 9.1379
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_8A9D9ACCB.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT  Ed+ l+ +vk +G g+Wk ++ + g+ R++k+c++rw++yl
  Traes_4DL_8A9D9ACCB.1 14 RGAWTSKEDDTLASYVKAHGEGRWKEVPLKAGLQRCGKSCRLRWLNYL 61
                           89********************************************97 PP

2Myb_DNA-binding51.13e-1667111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Traes_4DL_8A9D9ACCB.1  67 RGNISDDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111
                            7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.249961IPR017930Myb domain
SuperFamilySSF466894.69E-2811108IPR009057Homeodomain-like
SMARTSM007172.0E-111363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-231568IPR009057Homeodomain-like
CDDcd001672.58E-91661No hitNo description
PROSITE profilePS5129425.25662116IPR017930Myb domain
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.6E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2369115IPR009057Homeodomain-like
CDDcd001676.47E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRRACSANE GVKRGAWTSK EDDTLASYVK AHGEGRWKEV PLKAGLQRCG KSCRLRWLNY  60
LRPSIKRGNI SDDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRKVLPAR  120
LDTTRMVASP GASAGSCSST GAATSALSSN CGAGTSAKAA APPLSIAVWA PKPVRCTGGL  180
FFGRDAPPPP VTETRAVGGD GDECSGSSLG ASSGGGDWMD DVRALSSFLE SDEDWVNSLQ  240
MVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-27911622128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2521460.0AB252146.1 Triticum aestivum Tamyb3 mRNA for myb-related protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436658.15e-88hypothetical protein SORBIDRAFT_10g006700
SwissprotP102901e-82MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLW5EJH71e-176W5EJH7_WHEAT; Uncharacterized protein
STRINGGRMZM2G701063_P019e-89(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.19e-48myb domain protein 7
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]